PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_32735_BGI-A2_v1.0
Common NameF383_21796
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 295aa    MW: 32649.9 Da    PI: 8.1539
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_32735_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.6e-181461148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                +g+W +eEde+l+++++++G g+W++ ++  g++R++k+c++rw +yl
  Cotton_A_32735_BGI-A2_v1.0 14 KGPWGPEEDEILINYINKHGHGSWRSLPKLAGLRRCGKSCRLRWTNYL 61
                                79********************************************97 PP

2Myb_DNA-binding491.4e-1567112148
                                 TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                 rg++T +E++l +++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  Cotton_A_32735_BGI-A2_v1.0  67 RGPFTLDEEKLVIQLHAILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 112
                                 89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.56965IPR017930Myb domain
SuperFamilySSF466891.95E-3011108IPR009057Homeodomain-like
SMARTSM007173.7E-141363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001671.92E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.71166116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
CDDcd001672.61E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRTPCCERK GLKKGPWGPE EDEILINYIN KHGHGSWRSL PKLAGLRRCG KSCRLRWTNY  60
LRPDIKRGPF TLDEEKLVIQ LHAILGNRWA AIASQLPGRT DNEIKNLWNT HLKKRLLCMG  120
VDPLTHEPVT SGGPTTRPRS SPATRHMAQW ESARLEAEAR LSKGSLFFNS PPTSVKPDPD  180
FFLRLWNSEV GESFRKLNGE AKTDCRSPIS QASSSTKCGS VSGVTVDVGP IAAGSSTPKS  240
SRTEDPIMFD ASFSSCSNES EDSSDTALQL LLDFPINNDM SFLEDVDTYA TPLQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591694e-70AJ459169.1 Gossypium hirsutum partial myb139 gene, clone pGhMYB139.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482512.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0B0MK450.0A0A0B0MK45_G
STRINGPOPTR_0014s07700.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-121myb domain protein 17